PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_B44C0D37C.1
Common NameWM27A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 255aa    MW: 28281.1 Da    PI: 9.7991
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_B44C0D37C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.44.4e-29959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s
  Traes_1BL_B44C0D37C.1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59
                           79***********************************************86 PP

2K-box104.91e-3483173999
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                             + + +++ qqe+akL+ +i++Lq+ +R+l+Ge++++L+lkeL++Le++L+k++ +iR+kK+ell+++ie++qk e +lq+en++Lr+
  Traes_1BL_B44C0D37C.1  83 IDVNSQQYFQQESAKLRHQIQSLQNANRNLMGESVGNLTLKELKSLENRLDKGIGRIRAKKHELLFAEIEYMQKLEVDLQSENMYLRA 170
                            5667789********************************************************************************* PP

                  K-box  97 kle 99 
                            k++
  Traes_1BL_B44C0D37C.1 171 KVA 173
                            *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-31273IPR002100Transcription factor, MADS-box
CDDcd002651.49E-42271No hitNo description
PRINTSPR004042.3E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-2686172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.27388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN  60
STRTTIDRYK KASASASGSA PAIDVNSQQY FQQESAKLRH QIQSLQNANR NLMGESVGNL  120
TLKELKSLEN RLDKGIGRIR AKKHELLFAE IEYMQKLEVD LQSENMYLRA KVADAERLAL  180
AAPPPAPGGA ELEVLPTFDA RSYYHHQAVN MLQDAAAASS SSRYSQSSQA AAATTALHLG  240
YQIKGSQVPT ELIDR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q6e-20173173Myocyte-specific enhancer factor 2B
1tqe_R6e-20173173Myocyte-specific enhancer factor 2B
1tqe_S6e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028940.0AM502894.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM27A (WM27A gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266821.11e-135uncharacterized protein LOC100832541
RefseqXP_010230319.11e-135PREDICTED: uncharacterized protein LOC100832541 isoform X1
SwissprotQ8RU311e-116MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA9J2150.0A9J215_WHEAT; MIKC-type MADS-box transcription factor WM27A
STRINGBRADI2G25090.11e-135(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.19e-83MIKC_MADS family protein
Publications ? help Back to Top
  1. Paolacci AR,Tanzarella OA,Porceddu E,Varotto S,Ciaffi M
    Molecular and phylogenetic analysis of MADS-box genes of MIKC type and chromosome location of SEP-like genes in wheat (Triticum aestivum L.).
    Mol. Genet. Genomics, 2007. 278(6): p. 689-708
    [PMID:17846794]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]